PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000852271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 581aa    MW: 65175.6 Da    PI: 4.5827
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000852271genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.29.8e-51181492128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k......kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                    +pGfrFhPtdeelv +yLk+k+ +k+l++ +vi+e+d+yk++P++Lp k       +k+++++w+fFs+rd+ky++g r++rat++gyWk+tgkd+
  MDP0000852271  18 APGFRFHPTDEELVLYYLKRKICKKRLKI-DVIAETDVYKWDPEELPgKgfrelsLLKTGDRQWFFFSPRDRKYPNGGRSSRATRHGYWKTTGKDR 112
                    69***************************.99***************658888876677999********************************** PP

            NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++  ++ vglkktLv+ykgrap+ge+tdWvmhey++
  MDP0000852271 113 NIVC-YSRSVGLKKTLVYYKGRAPSGERTDWVMHEYTM 149
                    ****.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-5514172IPR003441NAC domain
PROSITE profilePS5100551.82517172IPR003441NAC domain
PfamPF023651.6E-2619148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MVTEDDPAAL FCDGHFAAPG FRFHPTDEEL VLYYLKRKIC KKRLKIDVIA ETDVYKWDPE  60
ELPGKGFREL SLLKTGDRQW FFFSPRDRKY PNGGRSSRAT RHGYWKTTGK DRNIVCYSRS  120
VGLKKTLVYY KGRAPSGERT DWVMHEYTMD EEELKRCQNV QQYYALYKAY KKSGPGPKNG  180
EQYGAPFREE DWVDDESPVI KTSADCQISV KEAVDVVSID NVKGNGEVHY ALDDIEEFMK  240
QMADEAVLPQ MNGYGYTAPQ VVSEEDTQSG LVDLYSREVF SPELIKEFNP NVQQCNVEAN  300
FDFTQSATSQ MQSHEASEVT TAVPDIYEHG PPALHEEDFL EMDDLLGPEP TVPNTLNPVD  360
DLQFGELDGL SEFDLYHDAA MFLHDLGPID EGNISHHQYM NSQGNTIVDQ FEYHLQPNPA  420
AENQVNHMLN PELAQMNNQL WTNTERAEPN QGSLSYSTSG VVYESSNFPS RATQNQSGNE  480
AAGATSQFSS ALWAFVESIP TTPASASESA LVNRAFERMS SFSRLRINTA STTVAAGNGS  540
ETMRAGIRRG FFFLPVLVAL CAIFWVLMAT LRPPGRCLPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-451914917140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.150560.0bud| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381037.10.0PREDICTED: uncharacterized protein LOC103443912
SwissprotQ9XIC51e-167NAC17_ARATH; NAC domain-containing protein 17
TrEMBLM5W6F50.0M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-147NAC domain containing protein 17